Oleiphilus messinensis: OLMES_3988 Help Entry OLMES_3988        CDS       T04860                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism ome  Oleiphilus messinensis Pathway ome00362   Benzoate degradation ome01100   Metabolic pathways ome01120   Microbial metabolism in diverse environments ome01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:ome00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     OLMES_3988    00622 Xylene degradation     OLMES_3988    00621 Dioxin degradation     OLMES_3988 Enzymes [BR:ome01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      OLMES_3988 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 MRX4_C Mtb12_C SufE Tautomerase_3 Motif Other DBs NCBI-ProteinID:  ARU58007 UniProt:  A0A1Y0IBV6 LinkDB All DBs Position 4528760..4528966 Genome browser AA seq 68 aa AA seqDB search MPYINIKITDESVTAEQKAKLIQGATQLLVDVLNKNPATTVVVIDEVNTDNWGIGGEVVT KLREQAQS NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgccctacatcaacatcaaaataacggacgaatctgttactgccgaacaaaaagcgaaa ctgattcaaggggccactcaattgttagtggacgtgttaaacaaaaaccctgcgaccaca gttgttgtcatcgacgaagtcaatacagataactggggtattggcggtgaggttgtgaca aaattgcgtgaacaggctcagtcttga

DBGET integrated database retrieval system