Oryzias melastigma (Indian medaka): 112138473 Help Entry 112138473         CDS       T07439                                  Name (RefSeq) claudin-4-like   KO K06087   claudin Organism oml  Oryzias melastigma (Indian medaka) Pathway oml03272   Virion - Hepatitis viruses oml04382   Cornified envelope formation oml04514   Cell adhesion molecules oml04530   Tight junction Brite KEGG Orthology (KO) [BR:oml00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     112138473  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     112138473  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     112138473  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     112138473  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oml03037]     112138473    04147 Exosome [BR:oml04147]     112138473    04515 Cell adhesion molecules [BR:oml04515]     112138473 Cilium and associated proteins [BR:oml03037]  Other cilia and associated proteins   Stereociliary proteins    112138473 Exosome [BR:oml04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    112138473   Exosomal proteins of colorectal cancer cells    112138473 Cell adhesion molecules [BR:oml04515]  Immunoglobulin superfamily   L1 family    112138473 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Motif Other DBs NCBI-GeneID:  112138473 NCBI-ProteinID:  XP_024116798 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MSSLMTFRRTFRPASSVSDSLSHDSSVSVHVTPKPPEPRLPVSGKDCAVRASEASSCPMA LQELGISLSMTGLAGTILICALPMWKVTAFIGTHLVVMQVFWEGLWMTCVSEYTGQMQCK LYDALLDLSPDLQAARGLIC NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgtcgtctttgatgacgttcagacgtacattccgtcccgcttcctcagtttctgactca ctctcacatgattcgtcggtttcggtacacgtgactcccaaaccgccagaaccacgtctt ccggtgtctgggaaagactgcgcagtgagggcttcagaggcttcctcgtgtcccatggcg ctgcaggagctgggcatcagtctgtccatgacgggtctggctggcaccatcctgatctgt gctctacccatgtggaaggtgacggccttcatcggcacccacctggtggtcatgcaggtc ttctgggaggggttgtggatgacctgcgtcagcgagtacactggccagatgcagtgcaag ctctacgacgccttgctggacctgtcgccggacctgcaggccgctcgaggcctcatctgc

DBGET integrated database retrieval system