Oryzias melastigma (Indian medaka): 112140944 Help Entry 112140944         CDS       T07439                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism oml  Oryzias melastigma (Indian medaka) Pathway oml04137   Mitophagy - animal oml04140   Autophagy - animal oml04144   Endocytosis oml04145   Phagosome oml04148   Efferocytosis oml05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oml00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112140944    04145 Phagosome     112140944    04140 Autophagy - animal     112140944    04137 Mitophagy - animal     112140944    04148 Efferocytosis     112140944  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112140944  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oml04131]     112140944   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oml04147]     112140944    04031 GTP-binding proteins [BR:oml04031]     112140944 Membrane trafficking [BR:oml04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     112140944 Exosome [BR:oml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112140944   Exosomal proteins of other body fluids (saliva and urine)    112140944   Exosomal proteins of colorectal cancer cells    112140944   Exosomal proteins of bladder cancer cells    112140944 GTP-binding proteins [BR:oml04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     112140944 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA cobW Motif Other DBs NCBI-GeneID:  112140944 NCBI-ProteinID:  XP_024119740 LinkDB All DBs Position Unknown AA seq 183 aa AA seqDB search FPPNFLIIICSTRAGEALPRPLLLVIFDPFDLPYCLPLSVICYTIKHLLSLKIWRFHSCL CFLLSVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSL GVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQ VII NT seq 552 nt NT seq  +upstreamnt  +downstreamnt tttcctcctaattttctaattattatctgtagtacacgtgcaggtgaggcactgccacgc ccacttctcctggtgatatttgatccctttgacttgccgtactgccttcccttatctgtg atctgttacaccatcaaacaccttctcagtttgaagatctggagatttcattcttgttta tgttttcttctcagtgttggaaagacttcactcatgaaccaatatgtgaacaaaaaattt agcaaccagtacaaagccacaataggagccgatttcctgaccaaggaggtgatggtggat gacagactggtaacgatgcagatctgggacacggccggtcaggagaggttccagtctttg ggggttgccttctaccgtggagcggactgctgcgtcctggtttttgatgtgaccgccccc aacaccttcaaaactctcgacagctggagggacgagtttctaatccaggccagccctcga gatcccgagaactttccctttgtggttctaggcaacaagatcgatctggagaacagacag gtgatcatctga

DBGET integrated database retrieval system