Oryzias melastigma (Indian medaka): 112142690 Help Entry 112142690         CDS       T07439                                  Name (RefSeq) insulin   KO K04526   insulin Organism oml  Oryzias melastigma (Indian medaka) Pathway oml04010   MAPK signaling pathway oml04068   FoxO signaling pathway oml04081   Hormone signaling oml04114   Oocyte meiosis oml04140   Autophagy - animal oml04150   mTOR signaling pathway oml04810   Regulation of actin cytoskeleton oml04910   Insulin signaling pathway oml04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:oml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112142690    04068 FoxO signaling pathway     112142690    04150 mTOR signaling pathway     112142690   09133 Signaling molecules and interaction    04081 Hormone signaling     112142690  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112142690   09143 Cell growth and death    04114 Oocyte meiosis     112142690   09142 Cell motility    04810 Regulation of actin cytoskeleton     112142690  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     112142690    04914 Progesterone-mediated oocyte maturation     112142690  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oml04052]     112142690 Cytokines and neuropeptides [BR:oml04052]  Neuropeptides   Unclassified    112142690 SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Chi-conotoxin Motif Other DBs NCBI-GeneID:  112142690 NCBI-ProteinID:  XP_024121986 Ensembl:  ENSOMEG00000004777 LinkDB All DBs Position LG14:21683651..21684575 Genome browser AA seq 104 aa AA seqDB search MATLWIHTASLLILLVTSFPTTQAATMQHLCGSHLVEALYIVCGDGGFFYNPQNVPASPV QSRAASETEGAAFRDQMKAIAKRNILERCCYTPCTIYDLASYCS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggcaactctgtggatacacactgcttcactgctgatcttactggtgacgtcttttcca acgacacaagccgccactatgcagcatctctgtgggagtcacctggttgaagccctgtac atcgtttgtggagacggaggctttttctacaaccctcagaacgttcctgccagcccagtc cagagcagagcggcatccgaaaccgagggcgcggcctttcgggaccagatgaaggcgata gctaaacgaaacattctggagcgctgctgttacacgccctgcaccatctacgacctggcg agctattgttcctga

DBGET integrated database retrieval system