Oryzias melastigma (Indian medaka): 112143725 Help Entry 112143725         CDS       T07439                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism oml  Oryzias melastigma (Indian medaka) Pathway oml04010   MAPK signaling pathway oml04144   Endocytosis oml04370   VEGF signaling pathway oml04510   Focal adhesion oml04520   Adherens junction oml04530   Tight junction oml04810   Regulation of actin cytoskeleton oml04912   GnRH signaling pathway oml05100   Bacterial invasion of epithelial cells oml05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112143725 (cdc42l)    04370 VEGF signaling pathway     112143725 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112143725 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     112143725 (cdc42l)    04520 Adherens junction     112143725 (cdc42l)    04530 Tight junction     112143725 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112143725 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     112143725 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112143725 (cdc42l)    05100 Bacterial invasion of epithelial cells     112143725 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oml04131]     112143725 (cdc42l)    03036 Chromosome and associated proteins [BR:oml03036]     112143725 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oml04147]     112143725 (cdc42l)    04031 GTP-binding proteins [BR:oml04031]     112143725 (cdc42l) Membrane trafficking [BR:oml04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     112143725 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     112143725 (cdc42l)   Macropinocytosis    Ras GTPases     112143725 (cdc42l) Chromosome and associated proteins [BR:oml03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     112143725 (cdc42l) Exosome [BR:oml04147]  Exosomal proteins   Exosomal proteins of microglial cells    112143725 (cdc42l)   Exosomal proteins of breast milk    112143725 (cdc42l) GTP-binding proteins [BR:oml04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     112143725 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  112143725 NCBI-ProteinID:  XP_024123670 Ensembl:  ENSOMEG00000013478 LinkDB All DBs Position LG16:6057265..6061309 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPSTPFLLVGTQVDLR EDSNTIEKLAKNKQRPLHPESGDKLARELRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKTKKKCLLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactataaaatgcgtagtggtaggagacggtgcagtaggaaagacctgcttactg atctcctacacaaccaacaagttcccctcagaatatgtgccaacagtttttgacaattat gcagtgacagtgatgattgggggagagccatacacccttggcctttttgacacagcaggt caggaggattatgacaggctgcgtcctctcagttacccacaaacagacgtcttccttgta tgtttctctgtcgtctccccatcatcgtttgaaaatgtcaaagagaagtgggtccctgag atttcacatcactgcccaagcacacctttccttttggtggggacccaagtagacctgcgg gaagacagcaacactattgagaagctggcgaaaaacaaacagcggcccctccacccagag agcggtgataagttggcacgtgagctcagggctgtcaaatatgtggaatgctccgctctc acacagcgaggacttaagaatgtctttgatgaggccatactggcagctctggaacctcct gaaaccaaaacgaagaagaaatgtcttcttctatag

DBGET integrated database retrieval system