Oryzias melastigma (Indian medaka): 112146753 Help Entry 112146753         CDS       T07439                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism oml  Oryzias melastigma (Indian medaka) Pathway oml04010   MAPK signaling pathway oml04137   Mitophagy - animal oml04140   Autophagy - animal oml04218   Cellular senescence oml04371   Apelin signaling pathway oml04625   C-type lectin receptor signaling pathway oml04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:oml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112146753 (rras)    04371 Apelin signaling pathway     112146753 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112146753 (rras)    04137 Mitophagy - animal     112146753 (rras)   09143 Cell growth and death    04218 Cellular senescence     112146753 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112146753 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112146753 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oml04147]     112146753 (rras)    04031 GTP-binding proteins [BR:oml04031]     112146753 (rras) Exosome [BR:oml04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    112146753 (rras)   Exosomal proteins of bladder cancer cells    112146753 (rras) GTP-binding proteins [BR:oml04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     112146753 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  112146753 NCBI-ProteinID:  XP_024128501 Ensembl:  ENSOMEG00000000343 UniProt:  A0A3B3DII0 LinkDB All DBs Position LG8:24249209..24266817 Genome browser AA seq 196 aa AA seqDB search MGEEDKYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYSKSYTVDGKVTRLDILD TAGQEEFGAMREQYMRSGEGFLLVFALNDRGSYHEVQKFHTQILRVKDRDDFPMVLVGNK ADLEQQRVISREDAQSFAQENSIHYMEASAKNRYNVEEVFMELVDIIRRFQEMESPPPQA QHTGKQKSGGCPCVLL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgggtgaagaagacaagtacaagctggtcgtagtggggggaggaggagtggggaagagc gcgctgaccatccagttcatccagtcgtactttgtgtcggactatgacccaaccattgag gactcctactccaagtcgtacactgtggacgggaaggtgacccggctggacattttggac acagccggtcaagaggagttcggagcgatgagggagcagtacatgcgctcaggagagggc tttttactggtgttcgctctgaacgaccggggcagttaccatgaggtccagaagtttcac acccagatcctgagagtgaaggatcgagatgacttccccatggttctggtgggaaacaag gctgacctggagcagcagagagtgatctccagagaggatgcccagagctttgcccaagag aacagtattcactatatggaggcctcagccaagaaccgctacaatgtggaagaagtgttc atggagctggtggacataatcaggaggtttcaagagatggaaagtcctcctccccaagct cagcacacaggcaaacagaagagtggtggctgtccctgtgtcctcctctga

DBGET integrated database retrieval system