Oryzias melastigma (Indian medaka): 112149863 Help Entry 112149863         CDS       T07439                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism oml  Oryzias melastigma (Indian medaka) Pathway oml04814   Motor proteins oml05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oml00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     112149863 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112149863 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oml03037]     112149863 (dynll2a)    04812 Cytoskeleton proteins [BR:oml04812]     112149863 (dynll2a) Cilium and associated proteins [BR:oml03037]  Motile cilia and associated proteins   Dynein arm    112149863 (dynll2a) Cytoskeleton proteins [BR:oml04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      112149863 (dynll2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  112149863 NCBI-ProteinID:  XP_024133597 Ensembl:  ENSOMEG00000004098 LinkDB All DBs Position LG13:complement(11219055..11223069) Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEEMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaggcggtgatcaagaacgctgacatgtccgaggagatgcagcaggac gccgtggactgtgccacacaggccatggagaaatacaacatagagaaggacattgctgcc tacattaagaaggagtttgataagaagtacaacccgacctggcactgcatcgtcgggaga aacttcggcagctacgtcacccacgagacaaagcattttatttacttctacttgggccaa gtagccattttgctctttaagtccggctga

DBGET integrated database retrieval system