Oryzias melastigma (Indian medaka): 112151792 Help Entry 112151792         CDS       T07439                                  Symbol hrasa Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism oml  Oryzias melastigma (Indian medaka) Pathway oml04010   MAPK signaling pathway oml04012   ErbB signaling pathway oml04068   FoxO signaling pathway oml04137   Mitophagy - animal oml04140   Autophagy - animal oml04144   Endocytosis oml04150   mTOR signaling pathway oml04210   Apoptosis oml04218   Cellular senescence oml04370   VEGF signaling pathway oml04371   Apelin signaling pathway oml04510   Focal adhesion oml04540   Gap junction oml04625   C-type lectin receptor signaling pathway oml04810   Regulation of actin cytoskeleton oml04910   Insulin signaling pathway oml04912   GnRH signaling pathway oml04916   Melanogenesis oml05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112151792 (hrasa)    04012 ErbB signaling pathway     112151792 (hrasa)    04370 VEGF signaling pathway     112151792 (hrasa)    04371 Apelin signaling pathway     112151792 (hrasa)    04068 FoxO signaling pathway     112151792 (hrasa)    04150 mTOR signaling pathway     112151792 (hrasa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112151792 (hrasa)    04140 Autophagy - animal     112151792 (hrasa)    04137 Mitophagy - animal     112151792 (hrasa)   09143 Cell growth and death    04210 Apoptosis     112151792 (hrasa)    04218 Cellular senescence     112151792 (hrasa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     112151792 (hrasa)    04540 Gap junction     112151792 (hrasa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112151792 (hrasa)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112151792 (hrasa)   09152 Endocrine system    04910 Insulin signaling pathway     112151792 (hrasa)    04912 GnRH signaling pathway     112151792 (hrasa)    04916 Melanogenesis     112151792 (hrasa)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112151792 (hrasa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oml04131]     112151792 (hrasa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oml04147]     112151792 (hrasa)    04031 GTP-binding proteins [BR:oml04031]     112151792 (hrasa) Membrane trafficking [BR:oml04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     112151792 (hrasa)  Endocytosis   Macropinocytosis    Ras GTPases     112151792 (hrasa) Exosome [BR:oml04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    112151792 (hrasa)   Exosomal proteins of colorectal cancer cells    112151792 (hrasa) GTP-binding proteins [BR:oml04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     112151792 (hrasa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  112151792 NCBI-ProteinID:  XP_024136632 Ensembl:  ENSOMEG00000018719 LinkDB All DBs Position LG6:29215606..29220993 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PVRTVETRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLDPPDNGGED CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtggtggtcggagctggaggcgtggggaagagcgcgctcacc atccagctcatccagaaccacttcgtcgacgaatacgacccaactatagaggactcctac cggaagcaggtggtgatcgatggggagacgtgcctactggacatcctggacaccgcaggt caggaggagtacagcgccatgcgggaccagtacatgcggacgggggagggcttcctctgc gtcttcgccatcaacaacaccaagtcgtttgaggacatccatcagtacagggagcagatc aaacgggtgaaggactccgatgacgtccccatggtgctggtggggaacaagtgtgacctc ccagtgcgcacagtagaaacccggcaagcccaggaattagcccggtcctacggcatccct tacatcgagacctctgcaaaaacccggcagggagttgaagacgctttctacactctggtc agggagatcaggcagcataagctaaggaaattggacccccccgacaacggcggtgaggac tgcatgagctgtcggtgcgtggtctcctga

DBGET integrated database retrieval system