Oryzias melastigma (Indian medaka): 112153519 Help Entry 112153519         CDS       T07439                                  Name (RefSeq) insulin isoform X1   KO K04526   insulin Organism oml  Oryzias melastigma (Indian medaka) Pathway oml04010   MAPK signaling pathway oml04068   FoxO signaling pathway oml04114   Oocyte meiosis oml04140   Autophagy - animal oml04150   mTOR signaling pathway oml04810   Regulation of actin cytoskeleton oml04910   Insulin signaling pathway oml04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:oml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112153519    04068 FoxO signaling pathway     112153519    04150 mTOR signaling pathway     112153519  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112153519   09143 Cell growth and death    04114 Oocyte meiosis     112153519   09142 Cell motility    04810 Regulation of actin cytoskeleton     112153519  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     112153519    04914 Progesterone-mediated oocyte maturation     112153519  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oml04052]     112153519 Cytokines and neuropeptides [BR:oml04052]  Neuropeptides   Neuropeptides (Unclassified)    112153519 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  112153519 NCBI-ProteinID:  XP_024139571 Ensembl:  ENSOMEG00000012707 LinkDB All DBs Position LG10:complement(20131088..20135029) Genome browser AA seq 154 aa AA seqDB search MVTRIKMKCRVGSLLFNQSTVPRSLAYSPEGQRSGRPVRCTLTLMARASWVLLAVILLIY SPGATSAPLQHLCGSHLVDALFFVCGDRGFFYNPHRAHKRDLGNQLGFLSKRARQEERLW RDQSGRDEPKVKRGIVEQCCHKPCSIHHLEGYCD NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggtaaccaggataaaaatgaagtgtagggttggcagtctattattcaaccaatctact gtgccaaggagcctggcatacagcccagagggacagaggagtggcaggccggtgcgttgc actctcactcttatggccagggcatcatgggtgctgttagctgtgatcctgctgatctac tcgccaggggcaacctcggcgcccctccagcacctgtgtggctcccacctggtggacgcc cttttctttgtctgtggagaccggggctttttctacaaccctcaccgagcccacaagcgg gacctgggaaatcaacttggtttcctgtctaaaagggccagacaagaggagcggctgtgg agggatcagtctggccgtgatgaacctaaggtgaaaagagggattgtggagcagtgctgc cataagccatgcagcattcaccacctggagggctactgcgactga

DBGET integrated database retrieval system