Oryzias melastigma (Indian medaka): 112154292 Help Entry 112154292         CDS       T07439                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism oml  Oryzias melastigma (Indian medaka) Pathway oml04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:oml00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     112154292  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:oml04121]     112154292    03400 DNA repair and recombination proteins [BR:oml03400]     112154292 Ubiquitin system [BR:oml04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      112154292    Cul5 complex      112154292 DNA repair and recombination proteins [BR:oml03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      112154292 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  112154292 NCBI-ProteinID:  XP_024140907 Ensembl:  ENSOMEG00000021737 LinkDB All DBs Position LG19:8363361..8369595 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEDQRLYKDDQLLEDSKTLGDC GFTNQTARPQAPATVGLAFRTNDEMFEQLHIEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttcttaatgattcggcgtcacaagaccacaatcttcacagatgccaaagag tccaccactgtctatgagttaaaacgaattgttgaaggaatcctgaaaagagcacctgaa gaccagcggctctacaaagatgatcagttgctggaggacagcaaaactttgggggactgt ggatttactaatcagactgccagacctcaagcgccggctacagtgggtctagctttccgt acaaatgatgagatgttcgagcagctgcacatcgaggccttctctagccccccagaactg cccgatgtgatgaagccccaggactctggtagcactgccaatgagcaggcagtgcagtga

DBGET integrated database retrieval system