Oryzias melastigma (Indian medaka): 112156130 Help Entry 112156130         CDS       T07439                                  Symbol cxcl19 Name (RefSeq) C-X-C motif chemokine 19   KO K10030   interleukin 8 Organism oml  Oryzias melastigma (Indian medaka) Pathway oml04060   Cytokine-cytokine receptor interaction oml04218   Cellular senescence oml04620   Toll-like receptor signaling pathway oml04621   NOD-like receptor signaling pathway oml04622   RIG-I-like receptor signaling pathway oml05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oml00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112156130 (cxcl19)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     112156130 (cxcl19)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112156130 (cxcl19)    04621 NOD-like receptor signaling pathway     112156130 (cxcl19)    04622 RIG-I-like receptor signaling pathway     112156130 (cxcl19)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112156130 (cxcl19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oml04052]     112156130 (cxcl19)    00536 Glycosaminoglycan binding proteins [BR:oml00536]     112156130 (cxcl19) Cytokines and neuropeptides [BR:oml04052]  Cytokines   Chemokines    112156130 (cxcl19) Glycosaminoglycan binding proteins [BR:oml00536]  Heparan sulfate / Heparin   Chemokines    112156130 (cxcl19) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  112156130 NCBI-ProteinID:  XP_024144068 Ensembl:  ENSOMEG00000016466 LinkDB All DBs Position LG18:17801694..17805357 Genome browser AA seq 104 aa AA seqDB search MKICILLLLGTLAVLTDGIPPINRDYNTRCQCLKVESRIIPPDNLKSIKLVTEGAHCPET EIIAGLVTGEKVCLNPRSAWVKKLVHFVLEKQLNQQNALPKNQA NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaagatctgcattctgcttctgcttgggaccctggctgtcctcactgatggtatccca ccaataaacagggactacaacacacgctgtcaatgtctgaaagtggagtccaggatcatt cctccggacaacctgaagagcatcaagctggtcactgaaggagctcactgtcctgagaca gaaatcatagctggcctggtgaccggggagaaggtgtgtctgaacccgcggtccgcctgg gtgaagaagctggtccattttgttctggagaagcagctcaaccaacagaacgcactcccc aagaaccaagcctaa

DBGET integrated database retrieval system