Oryzias melastigma (Indian medaka): 112157086 Help Entry 112157086         CDS       T07439                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism oml  Oryzias melastigma (Indian medaka) Pathway oml03030   DNA replication oml03410   Base excision repair oml03420   Nucleotide excision repair oml03430   Mismatch repair oml03440   Homologous recombination Brite KEGG Orthology (KO) [BR:oml00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     112157086 (pold4)    03410 Base excision repair     112157086 (pold4)    03420 Nucleotide excision repair     112157086 (pold4)    03430 Mismatch repair     112157086 (pold4)    03440 Homologous recombination     112157086 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:oml03032]     112157086 (pold4)    03400 DNA repair and recombination proteins [BR:oml03400]     112157086 (pold4) DNA replication proteins [BR:oml03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     112157086 (pold4) DNA repair and recombination proteins [BR:oml03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       112157086 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      112157086 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  112157086 NCBI-ProteinID:  XP_024145389 LinkDB All DBs Position LG1:32308075..32308925 Genome browser AA seq 108 aa AA seqDB search MTTKRGLITDSFKVVKKKKRGGKQEKSPTPPPPQTEEVADPVQQEALQKLRDFDLNWRFG PCTGISRLQRWERAELHGLSPPQEVRELLLKAPADSEFSLSLWSEYPL NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgacgaccaagcggggactcatcaccgactccttcaaggtggtgaagaaaaagaagaga ggagggaagcaggagaagagccccacgccgccgccccctcagacagaagaggttgcagat cccgtccagcaggaggcgctgcagaagctcagagactttgacctgaactggagatttgga ccgtgcacagggatcagtcgtctgcagaggtgggagagagcagagctgcacggcctgagc cccccccaggaggtcagggagctgctgctgaaagcccccgcagactccgagttcagcctg agcctctggagcgagtatcctctgtga

DBGET integrated database retrieval system