Oryzias melastigma (Indian medaka): 112157203 Help Entry 112157203         CDS       T07439                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism oml  Oryzias melastigma (Indian medaka) Pathway oml03082   ATP-dependent chromatin remodeling oml04217   Necroptosis Brite KEGG Orthology (KO) [BR:oml00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     112157203  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112157203  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oml03036]     112157203   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oml04147]     112157203 Chromosome and associated proteins [BR:oml03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112157203 Exosome [BR:oml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112157203 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  112157203 NCBI-ProteinID:  XP_024145584 UniProt:  A0A3B3E1I4 LinkDB All DBs Position LG1:31431253..31431684 Genome browser AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKPAKTK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggaaagaccggcggcaaagcccgagccaaggcgaagacccgctcctcc cgcgctgggctgcagttccccgtgggtcgtgtccacaggctgctgcgcaaaggcaactat gcggagcgtgtgggagccggagcccccgtgtacctggccgccgtgctggagtatctgacc gctgagatcctggagctggcgggaaacgccgcccgcgacaacaagaagaccaggatcatc ccccgtcacctgcagctggctgtccgcaacgacgaggagctcaacaagctgctgggcgga gtcaccatcgctcagggcggcgtgctgcccaacatccaggcggtgctgctgcccaagaag accgagaagcccgccaagaccaagtag

DBGET integrated database retrieval system