Oryzias melastigma (Indian medaka): 112159207 Help Entry 112159207         CDS       T07439                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism oml  Oryzias melastigma (Indian medaka) Pathway oml04081   Hormone signaling oml04144   Endocytosis oml04150   mTOR signaling pathway oml04270   Vascular smooth muscle contraction oml04310   Wnt signaling pathway oml04350   TGF-beta signaling pathway oml04510   Focal adhesion oml04520   Adherens junction oml04530   Tight junction oml04621   NOD-like receptor signaling pathway oml04625   C-type lectin receptor signaling pathway oml04810   Regulation of actin cytoskeleton oml05100   Bacterial invasion of epithelial cells oml05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oml00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     112159207    04350 TGF-beta signaling pathway     112159207    04150 mTOR signaling pathway     112159207   09133 Signaling molecules and interaction    04081 Hormone signaling     112159207  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112159207  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     112159207  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oml04131]     112159207   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oml04147]     112159207    04031 GTP-binding proteins [BR:oml04031]     112159207 Membrane trafficking [BR:oml04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     112159207 Exosome [BR:oml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112159207   Exosomal proteins of other body fluids (saliva and urine)    112159207   Exosomal proteins of colorectal cancer cells    112159207   Exosomal proteins of bladder cancer cells    112159207 GTP-binding proteins [BR:oml04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     112159207 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA VASP_tetra Motif Other DBs NCBI-GeneID:  112159207 NCBI-ProteinID:  XP_024148893 Ensembl:  ENSOMEG00000000358 LinkDB All DBs Position LG7:9970418..9974483 Genome browser AA seq 193 aa AA seqDB search MSAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGRQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDENTRRELAKMKQEPVKFEDGREMANRISAFGYQECSAKTKDGVREVFEMATRAALQ AKRNRKKPVCILL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgtctgcgatcaggaagaagttggtgatcgttggggatggtgcttgcgggaagacttgt ctgcttattgttttcagtaaagatcagtttccagaagtgtacgtgcccactgtgtttgag aactatgtcgcagacatcgaggtggatggaaggcaggtagaactggcgctttgggataca gcaggtcaagaagactatgaccgactgaggcctctgtcctaccccgacactgatgtcatc ctcatgtgtttctctgtggacagtcctgacagtttagagaatattccagaaaagtggact cccgaagtgaaacatttttgtccaaatgtccccatcatcctggtgggaaacaaaaaagat ctgcgcaacgatgagaacaccagacgagagcttgccaaaatgaaacaggagccagttaaa tttgaagacgggagagagatggcaaaccgcatcagtgccttcggctaccaggagtgttcc gccaaaaccaaagacggggtgagggaagttttcgagatggcaacaagagcagcactgcag gccaagagaaacagaaagaagcccgtctgcatcctgttatag

DBGET integrated database retrieval system