Oryzias melastigma (Indian medaka): 112160581 Help Entry 112160581         CDS       T07439                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism oml  Oryzias melastigma (Indian medaka) Brite KEGG Orthology (KO) [BR:oml00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oml03036]     112160581   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oml04147]     112160581 Chromosome and associated proteins [BR:oml03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112160581 Exosome [BR:oml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112160581 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  112160581 NCBI-ProteinID:  XP_024150984 LinkDB All DBs Position LG3:complement(11426218..11426780) Genome browser AA seq 98 aa AA seqDB search MKAPLRHVHRSPAQTKKRVQSYSTFIYKVHKQVCPAAMRSTDLLVSLQLVLPRLVLFRLV SSEASRLSKNNRLKAVTLQEIDAAVTIVQKRLSSKAAA NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaaagcccctctccgacatgtccacaggagtcctgcacagacaaagaagagggttcaa agttactccacctttatctacaaagttcacaaacaggtgtgtccagctgccatgaggagc acagacttgttggtaagtctgcagctcgttcttcccagactggtcctgttcagactggtg agctccgaagcttctcgactgtccaagaacaacagactgaaggctgtcactctgcaggag attgatgctgccgttacaattgtacagaagaggctgagttcaaaagctgctgcttga

DBGET integrated database retrieval system