Oryzias melastigma (Indian medaka): 112161216 Help Entry 112161216         CDS       T07439                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism oml  Oryzias melastigma (Indian medaka) Pathway oml03030   DNA replication oml03082   ATP-dependent chromatin remodeling oml03410   Base excision repair oml03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:oml00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     112161216 (pole3)    03410 Base excision repair     112161216 (pole3)    03420 Nucleotide excision repair     112161216 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     112161216 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:oml03032]     112161216 (pole3)    03036 Chromosome and associated proteins [BR:oml03036]     112161216 (pole3)    03400 DNA repair and recombination proteins [BR:oml03400]     112161216 (pole3) Enzymes [BR:oml01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      112161216 (pole3) DNA replication proteins [BR:oml03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     112161216 (pole3) Chromosome and associated proteins [BR:oml03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     112161216 (pole3) DNA repair and recombination proteins [BR:oml03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       112161216 (pole3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C dCMP_cyt_deam_2 Afi1 DUF4746 CIS_TMP RNA_pol_3_Rpc31 Bromo_TP ECM10 Motif Other DBs NCBI-GeneID:  112161216 NCBI-ProteinID:  XP_024152039 Ensembl:  ENSOMEG00000003317 UniProt:  A0A3B3BA00 LinkDB All DBs Position LG3:complement(6665201..6669863) Genome browser AA seq 147 aa AA seqDB search MAEKPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFALKAK RKTLNAGDVMAAMEEMEFERFLEPLRAALEVYKKGQKGKKEVSEQKRKEKKQADGEHEKN KEDEEGEDEEEQRMEEEPEEGEEEVEN NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggcggagaaaccggaggacctgaaccttcctaacgcggtcatcacgcgcatcatcaag gaggcgcttccagatggggtgaacgtgtccaaagaggcgcgcagagccatttcccaggct gccagtgtctttgtgctgtatgcaacctcctgcgccaataattttgcactgaaggccaaa cggaagactttaaatgctggggatgttatggcagcgatggaggagatggagtttgagcgc ttcctggagcctctcagagcagctctagaagtgtacaagaaaggacagaaaggaaagaag gaagtatctgagcagaaacgcaaagaaaaaaagcaggcagacggtgagcatgaaaagaac aaggaagatgaggagggagaggatgaggaagaacaacgtatggaagaggagcccgaggag ggcgaagaggaggtggagaactga

DBGET integrated database retrieval system