Oryzias melastigma (Indian medaka): 13540115 Help Entry 13540115          CDS       T07439                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism oml  Oryzias melastigma (Indian medaka) Pathway oml00190   Oxidative phosphorylation oml01100   Metabolic pathways Module oml_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:oml00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     13540115 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:oml03029]     13540115 (ND4L) Enzymes [BR:oml01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      13540115 (ND4L) Mitochondrial biogenesis [BR:oml03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     13540115 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 NAD4L Motif Other DBs NCBI-GeneID:  13540115 NCBI-ProteinID:  YP_006665917 UniProt:  J7F835 LinkDB All DBs Position MT:10039..10335 Genome browser AA seq 98 aa AA seqDB search MTPIHYACSSSYFMGLVGLVLYRTQLLSALLCLEAMMLILFISLSLWALQLMSTMFAACP MILLALSACEASAGLALLVATARSHGSGRLKNLSLLRC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacacctatccattatgcctgctcgtcatcttactttataggtcttgtaggcctagta ttatatcgaacacaactcctatctgcacttctatgcttagaagctataatgcttatcctt tttatctctctttccttatgagcccttcaacttatatcaacaatatttgctgcctgccct ataattcttttagctttatcagcttgtgaagcaagcgcaggacttgcccttttagttgcc accgcccgctcacatggaagcggccgacttaaaaacttaagcctcctacgatgttaa

DBGET integrated database retrieval system