Oxyplasma meridianum: OXIME_001004 Help Entry OXIME_001004      CDS       T10514                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism omr  Oxyplasma meridianum Pathway omr03010   Ribosome Brite KEGG Orthology (KO) [BR:omr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     OXIME_001004   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     OXIME_001004  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:omr03011]     OXIME_001004    04121 Ubiquitin system [BR:omr04121]     OXIME_001004 Ribosome [BR:omr03011]  Ribosomal proteins   Eukaryotes    Large subunit     OXIME_001004   Archaea     OXIME_001004 Ubiquitin system [BR:omr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    OXIME_001004 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR Zn_ribbon_3 zf-CHY Zn_ribbon_RanBP Cas12f1-like_TNB DHHC Motif Other DBs NCBI-ProteinID:  WYY00434 UniProt:  A0AAX4NGP3 LinkDB All DBs Position 978253..978402 Genome browser AA seq 49 aa AA seqDB search MAFPEAVERRLNKKICMKCNARNSPRAEKCRKCGYTGLRMKAKERRGGQ NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcattccctgaagcagttgaaagaagactaaacaaaaagatatgtatgaaatgtaat gctagaaactcccccagagcagaaaaatgcagaaaatgtggttatactggactgaggatg aaagcaaaggaaaggagaggcggacagtaa

DBGET integrated database retrieval system