Oncorhynchus mykiss (rainbow trout): 100136233 Help Entry 100136233         CDS       T07259                                  Symbol cd59 Name (RefSeq) CD59-like protein precursor   KO K04008   CD59 antigen Organism omy  Oncorhynchus mykiss (rainbow trout) Brite KEGG Orthology (KO) [BR:omy00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:omy04147]     100136233 (cd59)    04090 CD molecules [BR:omy04090]     100136233 (cd59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:omy00537]     100136233 (cd59) Exosome [BR:omy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100136233 (cd59)   Exosomal proteins of other body fluids (saliva and urine)    100136233 (cd59)   Exosomal proteins of colorectal cancer cells    100136233 (cd59) CD molecules [BR:omy04090]  Proteins   100136233 (cd59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:omy00537]  Antigens   100136233 (cd59) SSDB OrthologParalogGFIT Motif Pfam:  CD59 UPAR_LY6 Toxin_TOLIP Motif Other DBs NCBI-GeneID:  100136233 NCBI-ProteinID:  NP_001117969 Ensembl:  ENSOMYG00000042488 UniProt:  Q64HX7 A0A8C7UGS8 LinkDB All DBs Position 26:<17823487..17825226 Genome browser AA seq 119 aa AA seqDB search MNNYPGMCLVFCFAIFGLGSAIRCVKCKDDTGSCTTTQDCRVDEDACLTLAERGGQTTRQ CIKVSDCDFNRLAQMFPSVPKFTFDCCSSHLCNGATSIGTGKPLLGLLASLAVMWWCMQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgaataattatcctgggatgtgcttagtgttctgttttgcaatatttggattgggctct gccatccgctgtgtcaaatgcaaggatgacaccgggagctgcacaactacacaggactgc cgtgttgatgaggatgcctgcctgacactagctgagagagggggacagacaactcggcag tgcatcaaggtctctgactgcgacttcaatcgattggcccagatgtttccatctgtacca aaatttaccttcgattgttgcagcagtcacctatgcaacggagccacatccattggcact ggcaagcccttgctgggccttcttgcctcattggcagtgatgtggtggtgtatgcagtaa

DBGET integrated database retrieval system