Oncorhynchus mykiss (rainbow trout): 100136235 Help Entry 100136235         CDS       T07259                                  Symbol cpi1 Name (RefSeq) cystatin B   KO K13907   cystatin-A/B Organism omy  Oncorhynchus mykiss (rainbow trout) Brite KEGG Orthology (KO) [BR:omy00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:omy01002]     100136235 (cpi1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:omy04147]     100136235 (cpi1) Peptidases and inhibitors [BR:omy01002]  Peptidase inhibitors   Family I25: cystatin family    100136235 (cpi1) Exosome [BR:omy04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100136235 (cpi1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  100136235 NCBI-ProteinID:  NP_001117971 Ensembl:  ENSOMYG00000047292 UniProt:  Q64HX6 LinkDB All DBs Position Y:complement(32432210..32433588) Genome browser AA seq 98 aa AA seqDB search MKCGGTAEAKDATPEVQQICDEMKPYAEEKAAKKFDVFAAKTFTTQVVAGTNFFIKVHVG GDEFVHLRVHRTLPHAGGKLELHGVQTSKAHNDPIGFF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaagtgtggcggtaccgccgaggcgaaggatgccacacccgaagtgcagcaaatctgc gatgagatgaagccatatgcagaggagaaagctgcaaagaagtttgacgtttttgctgcc aaaacattcacaacgcaagttgtggctgggaccaacttcttcattaaagtccatgttggt ggagatgaatttgtgcacctgcgggtccatagaactctaccccacgctggtgggaaactg gagcttcatggcgtacagacatccaaagctcacaatgaccccattggtttcttctga

DBGET integrated database retrieval system