Oncorhynchus mykiss (rainbow trout): 100136702 Help Entry 100136702         CDS       T07259                                  Name (RefSeq) preproinsulin 1 precursor   KO K04526   insulin Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04010   MAPK signaling pathway omy04068   FoxO signaling pathway omy04081   Hormone signaling omy04114   Oocyte meiosis omy04140   Autophagy - animal omy04150   mTOR signaling pathway omy04810   Regulation of actin cytoskeleton omy04910   Insulin signaling pathway omy04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:omy00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100136702    04150 mTOR signaling pathway     100136702   09133 Signaling molecules and interaction    04081 Hormone signaling     100136702  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100136702  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:omy04052]     100136702 Cytokines and neuropeptides [BR:omy04052]  Neuropeptides   Unclassified    100136702 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  100136702 NCBI-ProteinID:  NP_001118141 Ensembl:  ENSOMYG00000034257 UniProt:  A3RID6 LinkDB All DBs Position 12:56253926..56255161 Genome browser AA seq 105 aa AA seqDB search MAYWLQAASLLVLLALSPGADAAAAQHLCGSHLVDALYLVCGEKGFFYNPKRDVDPLIGF LSPKSAKENEEYPFKDQMEMMVKRGIVEQCCHKPCNIFDLQNYCN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggcctattggctccaagctgcatctctgctggtgctgctggcgctctcccccggggca gacgctgcagctgcccagcacctgtgtggctctcacctggtggacgccctctatctggtg tgtggagagaaaggattcttttacaacccaaagagagatgtggatccccttatagggttc ctctctccaaaatcagcaaaggagaacgaagagtaccccttcaaagaccagatggagatg atggtaaagagaggtattgtagagcagtgctgtcacaagccctgcaacatcttcgacctg caaaactactgcaactga

DBGET integrated database retrieval system