Oncorhynchus mykiss (rainbow trout): 100136703 Help Entry 100136703         CDS       T07259                                  Name (RefSeq) preproinsulin 2 precursor   KO K04526   insulin Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04010   MAPK signaling pathway omy04068   FoxO signaling pathway omy04081   Hormone signaling omy04114   Oocyte meiosis omy04140   Autophagy - animal omy04150   mTOR signaling pathway omy04810   Regulation of actin cytoskeleton omy04910   Insulin signaling pathway omy04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:omy00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100136703    04068 FoxO signaling pathway     100136703    04150 mTOR signaling pathway     100136703   09133 Signaling molecules and interaction    04081 Hormone signaling     100136703  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100136703   09143 Cell growth and death    04114 Oocyte meiosis     100136703   09142 Cell motility    04810 Regulation of actin cytoskeleton     100136703  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     100136703    04914 Progesterone-mediated oocyte maturation     100136703  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:omy04052]     100136703 Cytokines and neuropeptides [BR:omy04052]  Neuropeptides   Unclassified    100136703 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  100136703 NCBI-ProteinID:  NP_001118142 UniProt:  A3RID7 LinkDB All DBs Position 10:complement(8637673..8638902) Genome browser AA seq 107 aa AA seqDB search MVLWLQAASLLVLLALYPGADAAAAQHLCGSHLVDALYLVCGEKGFFYNPKRDVDPLTGF LFPKSSQENEVAEYPFKDQMDMIVKRGIVEQCCHKPCNIFDLQNYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggtcctctggctccaagctgcatctctgctggtgctgctggccctctaccctggggca gacgctgcagctgcccaacacctgtgtggctctcatctggtggacgccctctatctggtg tgtggagagaaaggattcttttacaacccaaagagagatgtggatcccctaacagggttt ctctttccaaaatcgtcccaggagaacgaagttgccgagtacccgttcaaagaccagatg gacatgatagtaaagagaggtattgtagagcagtgctgtcacaagccttgcaacatcttc gacctgcagaactactgcaactga

DBGET integrated database retrieval system