| Entry |
|
|---|
| Symbol |
gbg12
|
|---|
| Name |
(RefSeq) Guanine nucleotide-binding protein GI/GS/GO gamma-12 subunit
|
|---|
| KO |
| K04347 | guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 |
|
|---|
| Organism |
omy Oncorhynchus mykiss (rainbow trout)
|
|---|
| Pathway |
| omy04810 | Regulation of actin cytoskeleton |
|
|---|
| Brite |
KEGG Orthology (KO) [BR:omy00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
100305310 (gbg12)
04371 Apelin signaling pathway
100305310 (gbg12)
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
100305310 (gbg12)
04081 Hormone signaling
100305310 (gbg12)
09140 Cellular Processes
09142 Cell motility
04810 Regulation of actin cytoskeleton
100305310 (gbg12)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:omy04147]
100305310 (gbg12)
04031 GTP-binding proteins [BR:omy04031]
100305310 (gbg12)
Exosome [BR:omy04147]
Exosomal proteins
Exosomal proteins of other body fluids (saliva and urine)
100305310 (gbg12)
Exosomal proteins of colorectal cancer cells
100305310 (gbg12)
GTP-binding proteins [BR:omy04031]
Heterotrimeric G-proteins
Gamma Subunits
Gamma [OT]
100305310 (gbg12)
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| Position |
8:53191105..53249559
|
|---|
| AA seq |
72 aa
MSSKMPSSNNIAQARRTVQQLRIEASIERIKVSKASADLMHYCGEHAKYDPLLMGIPASE
NPFKDKKPCTIL |
|---|
| NT seq |
219 nt +upstreamnt +downstreamnt
atgtcatcgaagatgccaagctctaacaacatagcccaagccaggaggacagtacaacag
ctgaggatagaggccagtattgagaggataaaggtatccaaggcctctgcggacctcatg
cactactgtggcgaacacgccaagtacgaccctctgctcatgggcatacctgcctcagag
aaccccttcaaggacaaaaagccttgcactatattgtag |
|---|
