Oncorhynchus mykiss (rainbow trout): 100305328 Help Entry 100305328         CDS       T07259                                  Symbol dynlt1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04145   Phagocytosis omy04814   Motor proteins omy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omy00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     100305328 (dynlt1)   09142 Cell motility    04814 Motor proteins     100305328 (dynlt1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100305328 (dynlt1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:omy03037]     100305328 (dynlt1)    04812 Cytoskeleton proteins [BR:omy04812]     100305328 (dynlt1) Cilium and associated proteins [BR:omy03037]  Motile cilia and associated proteins   Dynein arm    100305328 (dynlt1) Cytoskeleton proteins [BR:omy04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      100305328 (dynlt1) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  100305328 NCBI-ProteinID:  NP_001158705 Ensembl:  ENSOMYG00000020966 UniProt:  C1BF42 LinkDB All DBs Position 4:complement(24148542..24150192) Genome browser AA seq 113 aa AA seqDB search MDEFQTGEETAFVVDEVSTIIKESVEGAIGGNAYQHSRVNQWTTNVVEQSLSQLSKLGKP FKYIVTCVIMQKNGAGLQTASSCFWDNTTDGSCTVRWGNKSMYCIVSVFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggatgagtttcagactggagaagagactgcctttgtcgttgacgaagtgagcactatc atcaaagagtcagtagaaggagccataggaggaaatgcctatcaacatagcagagtgaac caatggaccaccaatgtagtggagcagtccctgagtcaacttagcaaactgggcaagcct ttcaagtacattgtgacctgtgttatcatgcagaaaaacggggcaggtctacagacagcc agctcatgcttctgggataacaccactgatggaagctgtacagtgaggtgggggaataaa tccatgtactgcatcgtcagtgtcttcggcctggccatctga

DBGET integrated database retrieval system