KEGG   Oncorhynchus mykiss (rainbow trout): 100653475
Entry
100653475         CDS       T07259                                 
Symbol
mrap
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
omy  Oncorhynchus mykiss (rainbow trout)
SSDB
Motif
Pfam: MRAP
Other DBs
NCBI-GeneID: 100653475
NCBI-ProteinID: NP_001233276
Ensembl: ENSOMYG00000036160
UniProt: F4NAR2
LinkDB
Position
24:complement(37191264..37193084)
AA seq 78 aa
MDSWRYEWEYYYDYLDPIPVDERKLKYNKYLIVIVFWISLAAFVGFLFAILTFMSRSVSL
PNSKTAKKSWRNPRSNSA
NT seq 237 nt   +upstreamnt  +downstreamnt
atggattcatggagatacgagtgggaatattactacgattacctagacccaataccagtg
gacgagcgcaaactgaaatataacaagtacttgatagtgatcgtattctggatcagtctg
gctgcttttgtgggattcctgtttgccattttgactttcatgtcccgttcagtcagtcta
cccaattccaaaacggccaagaaatcgtggaggaaccctagatccaattctgcttga

DBGET integrated database retrieval system