Oncorhynchus mykiss (rainbow trout): 110486673 Help Entry 110486673         CDS       T07259                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:omy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110486673  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:omy04121]     110486673    03400 DNA repair and recombination proteins [BR:omy03400]     110486673 Ubiquitin system [BR:omy04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      110486673    Cul5 complex      110486673 DNA repair and recombination proteins [BR:omy03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      110486673 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  110486673 NCBI-ProteinID:  XP_021414118 Ensembl:  ENSOMYG00000003874 LinkDB All DBs Position 13:complement(49215758..49219547) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEEQRLYKDDMLLEDSKTLGDC GFTNQTARPQAPGTVGLAFRLGDDAFEQLRVEPFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctgatgatccggcgtcacaagacgaccatcttcactgatgccaaagag tccactacggtctacgagctgaagcgcatagtggagggtatcctaaagagggcaccggag gaacagaggttgtacaaggatgacatgttgctggaggatagtaagactcttggagactgt ggcttcacaaatcagacagccagacctcaggccccagggactgttggattagctttccgt ctcggtgatgatgcatttgagcagctgagggttgagcccttctccagccccccagagctt cctgatgtcatgaagcctcaggactctggcagcacagccaatgagcaggctgtgcagtga

DBGET integrated database retrieval system