Oncorhynchus mykiss (rainbow trout): 110491761 Help Entry 110491761         CDS       T07259                                  Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:omy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110491761  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:omy04121]     110491761    03400 DNA repair and recombination proteins [BR:omy03400]     110491761 Ubiquitin system [BR:omy04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      110491761    Cul5 complex      110491761 DNA repair and recombination proteins [BR:omy03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      110491761 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  110491761 NCBI-ProteinID:  XP_021421147 Ensembl:  ENSOMYG00000044708 LinkDB All DBs Position 16:27332830..27359591 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRQKTTIFTDAKESTTVYELKRIVEGILKREPEEQRLFKDDQLLEDSKTLGDC GFTNQTARPQAPGTVGLAFRMGDEMFEQLQVGAFSSPPELPDVMKPQDSGSTANEQTVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttccttatgatccggcgtcagaagaccaccattttcacagatgccaaagag tccaccaccgtctacgagctgaagcgcattgtagagggaattctcaagagagagcctgag gaacagaggctcttcaaggatgaccagttgctagaagacagtaaaactcttggcgattgc ggcttcaccaaccagactgcaagacctcaggccccaggcactgttggactggctttccga atgggtgatgagatgtttgagcagctgcaggtgggggcattctccagccctccagagctc cctgacgtcatgaaaccccaagactctggcagcactgccaacgaacagactgtgcagtga

DBGET integrated database retrieval system