Oncorhynchus mykiss (rainbow trout): 110496976 Help Entry 110496976         CDS       T07259                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04010   MAPK signaling pathway omy04012   ErbB signaling pathway omy04068   FoxO signaling pathway omy04137   Mitophagy - animal omy04140   Autophagy - animal omy04144   Endocytosis omy04150   mTOR signaling pathway omy04210   Apoptosis omy04218   Cellular senescence omy04370   VEGF signaling pathway omy04371   Apelin signaling pathway omy04510   Focal adhesion omy04540   Gap junction omy04625   C-type lectin receptor signaling pathway omy04810   Regulation of actin cytoskeleton omy04910   Insulin signaling pathway omy04912   GnRH signaling pathway omy04916   Melanogenesis omy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omy00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110496976    04012 ErbB signaling pathway     110496976    04370 VEGF signaling pathway     110496976    04371 Apelin signaling pathway     110496976    04068 FoxO signaling pathway     110496976    04150 mTOR signaling pathway     110496976  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110496976    04140 Autophagy - animal     110496976    04137 Mitophagy - animal     110496976   09143 Cell growth and death    04210 Apoptosis     110496976    04218 Cellular senescence     110496976   09144 Cellular community - eukaryotes    04510 Focal adhesion     110496976    04540 Gap junction     110496976   09142 Cell motility    04810 Regulation of actin cytoskeleton     110496976  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110496976   09152 Endocrine system    04910 Insulin signaling pathway     110496976    04912 GnRH signaling pathway     110496976    04916 Melanogenesis     110496976  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110496976  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:omy04131]     110496976   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:omy04147]     110496976    04031 GTP-binding proteins [BR:omy04031]     110496976 Membrane trafficking [BR:omy04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     110496976  Endocytosis   Macropinocytosis    Ras GTPases     110496976 Exosome [BR:omy04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    110496976   Exosomal proteins of colorectal cancer cells    110496976 GTP-binding proteins [BR:omy04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     110496976 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin AAA_16 Motif Other DBs NCBI-GeneID:  110496976 NCBI-ProteinID:  XP_036812141 LinkDB All DBs Position 2:complement(78366116..78393964) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PSRTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaagttggtggtggtgggggctggaggtgtggggaagagtgcactcact atccagctcatccagaaccactttgtggatgaatacgaccccaccatagaggactcatac aggaagcaggtggtgattgatggggagacatgtctgctggacatcctggacactgcaggt caggaggagtacagcgctatgagggaccagtacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtcctttgaggacatccaccagtacagggaacagatc aagcgtgtgaaggactctgacgacgtgcccatggtcctggtgggtaataaatgtgacctc ccatcgcgtaccgtggacacgcggcaagcacaggaactggcccgcagctacggaattccc tacatcgagacctctgccaagacacgacagggggtggaggacgccttctacacgctagtg agagagatcaggcagcacaagctgaggaagctcaaccctccggatgagagtggacaggac tgcatgagctgccgctgtgtggtgtcgtga

DBGET integrated database retrieval system