Oncorhynchus mykiss (rainbow trout): 110503837 Help Entry 110503837         CDS       T07259                                  Name (RefSeq) tubulin beta chain   KO K07375   tubulin beta Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04145   Phagosome omy04540   Gap junction omy04814   Motor proteins omy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omy00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110503837   09144 Cellular community - eukaryotes    04540 Gap junction     110503837   09142 Cell motility    04814 Motor proteins     110503837  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110503837  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:omy03036]     110503837   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:omy04812]     110503837    04147 Exosome [BR:omy04147]     110503837 Chromosome and associated proteins [BR:omy03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      110503837 Cytoskeleton proteins [BR:omy04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     110503837 Exosome [BR:omy04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    110503837   Exosomal proteins of colorectal cancer cells    110503837   Exosomal proteins of bladder cancer cells    110503837 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tubulin_C Motif Other DBs NCBI-GeneID:  110503837 NCBI-ProteinID:  XP_036820033 LinkDB All DBs Position 3:19801239..19801909 Genome browser AA seq 125 aa AA seqDB search MSIKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNSTAIQELFKR ISEQFTAMFHRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEA EDDDP NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgtccataaaggaggtggacgagcagatgcttaatatccagaacaagaacagcagctac tttgtggaatggatccccaacaatgtgaagaccgctgtctgcgatatcccaccccgtggt ctaaaaatgtctgtcaccttcatcggcaacagcacagccatccaggagctgttcaagcgt atctctgagcagttcactgccatgttccaccgcaaggccttcttgcactggtatactgga gagggcatggacgagatggagttcactgaggcagagagcaacatgaacgacctggtgtct gagtaccagcagtaccaggacgccaccgctgaggaagagggagagttcgaggaggaggct gaagacgatgacccttaa

DBGET integrated database retrieval system