Oncorhynchus mykiss (rainbow trout): 110509007 Help Entry 110509007         CDS       T07259                                  Symbol pfn2l Name (RefSeq) profilin 2 like isoform X1   KO K05759   profilin Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04810   Regulation of actin cytoskeleton omy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omy00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110509007 (pfn2l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110509007 (pfn2l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:omy04131]     110509007 (pfn2l)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:omy04812]     110509007 (pfn2l)    04147 Exosome [BR:omy04147]     110509007 (pfn2l) Membrane trafficking [BR:omy04131]  Others   Actin-binding proteins    Others     110509007 (pfn2l) Cytoskeleton proteins [BR:omy04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      110509007 (pfn2l) Exosome [BR:omy04147]  Exosomal proteins   Proteins found in most exosomes    110509007 (pfn2l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  110509007 NCBI-ProteinID:  XP_021445616 Ensembl:  ENSOMYG00000025336 LinkDB All DBs Position 28:32673745..32681853 Genome browser AA seq 139 aa AA seqDB search MSWQSYVDNLMADGSCQDSAIVGYTDAKYVWAAHAGGTFNNITPQEIDVLIGKDRASFFT NGMTLGSKKCSVIRDSLHIEGDWTMDIRTKSQGGEPTYNVTVGKAGKALVLVMGKEGVHG GQLNKKAFTMTEYLRKSGF NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgtcttggcaaagctacgtggataacctgatggcggatggcagctgtcaggattccgcc attgttgggtatacggacgccaaatacgtttgggcagcacatgccggtggtacttttaac aacataacgcctcaagaaattgatgttctcattggaaaggacagggctagcttcttcacc aacggcatgaccttgggttcgaagaagtgctcggtcatcagagacagcctccatattgaa ggggactggacaatggacatcaggacaaagagtcaaggaggagagccaacatacaacgtc actgtaggcaaagccggaaaagcattggttttagtcatgggaaaagaaggggtccatggc ggacagctcaacaagaaagcatttactatgactgagtacctgaggaagtctggattttaa

DBGET integrated database retrieval system