Oncorhynchus mykiss (rainbow trout): 110520886 Help Entry 110520886         CDS       T07259                                  Name (RefSeq) protein S100-A1   KO K17274   protein S100-A10 Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04382   Cornified envelope formation omy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omy00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     110520886  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110520886  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:omy04147]     110520886 Exosome [BR:omy04147]  Exosomal proteins   Exosomal proteins of microglial cells    110520886 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 DEK_C DAXX_hist_bd EH Astro_p19 Motif Other DBs NCBI-GeneID:  110520886 NCBI-ProteinID:  XP_021454008 UniProt:  A0A8K9USH1 LinkDB All DBs Position 3:8265080..8266671 Genome browser AA seq 101 aa AA seqDB search MPSELERSMESLIMVFHRYAEKDGDGNTLSKKELKELMQTELGSFLKSQKDPAAIDKIMK DLDQNGDGKVNFEEFVSLVVGLSIACEQLYQLHTQKVAAKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgagttggagcgttccatggagtccctgatcatggtgttccatcgctatgct gaaaaggatggtgacggcaacacactgagcaagaaggagctgaaagagctgatgcagaca gaactgggcagcttcctgaagtcccagaaggacccagccgctatagacaagatcatgaag gatctggaccagaatggtgatgggaaggtgaactttgaggagtttgtctctctggtggtg ggcctctccatcgcctgtgaacagctctaccagctccacacccaaaaggttgctgctaag aagtga

DBGET integrated database retrieval system