Oncorhynchus mykiss (rainbow trout): 110520887 Help Entry 110520887         CDS       T07259                                  Name (RefSeq) protein S100-A1   KO K17274   protein S100-A10 Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04382   Cornified envelope formation omy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omy00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     110520887  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110520887  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:omy04147]     110520887 Exosome [BR:omy04147]  Exosomal proteins   Exosomal proteins of microglial cells    110520887 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EH DEK_C Motif Other DBs NCBI-GeneID:  110520887 NCBI-ProteinID:  XP_021454010 Ensembl:  ENSOMYG00000000686 LinkDB All DBs Position 3:8287965..8291009 Genome browser AA seq 101 aa AA seqDB search MLSQLERSMQSLITVFHRYADKDGDCNTLSKKELNELMQSELGSFLKSQKDPAAIDKIMK ILDQNGDGMVNFEEFVSLVVDLSIACEQIYQLHIMKAAAKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgctgtctcagttggagagatccatgcagtccctgatcacggtgttccatcgctatgcc gacaaggacggtgactgtaacacactgagcaagaaggagctgaatgaactcatgcagtca gaactgggcagcttcctgaagtcccagaaggacccagccgccatagacaagatcatgaag attctggaccagaatggtgatgggatggtaaacttcgaggagtttgtctccctggtggtg gacctctccatcgcctgtgaacagatctaccagctccacatcatgaaggctgccgctaag aagtga

DBGET integrated database retrieval system