Oncorhynchus mykiss (rainbow trout): 110521016 Help Entry 110521016         CDS       T07259                                  Name (RefSeq) ras-related protein R-Ras-like   KO K07830   Ras-related protein R-Ras2 Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04010   MAPK signaling pathway omy04137   Mitophagy - animal omy04140   Autophagy - animal omy04218   Cellular senescence omy04371   Apelin signaling pathway omy04625   C-type lectin receptor signaling pathway omy04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:omy00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110521016    04371 Apelin signaling pathway     110521016  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110521016    04137 Mitophagy - animal     110521016   09143 Cell growth and death    04218 Cellular senescence     110521016   09142 Cell motility    04810 Regulation of actin cytoskeleton     110521016  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110521016  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:omy04147]     110521016    04031 GTP-binding proteins [BR:omy04031]     110521016 Exosome [BR:omy04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    110521016   Exosomal proteins of bladder cancer cells    110521016 GTP-binding proteins [BR:omy04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     110521016 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  110521016 NCBI-ProteinID:  XP_036824661 LinkDB All DBs Position 30:complement(45022318..45045828) Genome browser AA seq 197 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDTGSYNEIHKFHTQILRVKDRDDFPMVLVGN KADLDQSRVISREEAQGFARENRIHYMEASAKNRYNVDEAFLEVVRAIRKFQETESPPLP ANHTGKRKSGGCPCTLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgtctgctgaggaggagagattcaagctggtcgtcgtgggcgggggcggtgtggggaaa agtgccttgaccatacaattcattcagtcatactttgtatcggattatgacccaaccatc gaggactcctacaccaaaatatgcacagtggatgggaaagagacacgattagacatcttg gacacagcaggtcaagaggagtttggggcaatgagggagcagtacatgcgctcaggagaa ggcttcttgctggtgttcgctctgaatgacactggcagttacaatgagatccacaagttc cacacccagatactgagagtgaaggaccgggatgacttccccatggtgctggtggggaac aaggctgacctggaccagtcgagagtgatctccagagaggaggcccagggctttgccaga gagaacaggatccattacatggaggcctcggctaagaaccgctacaacgtagacgaagcc ttcctggaggtggtgcgagctataagaaagtttcaggagactgagagtccccctctacct gcaaaccacacaggaaaacggaagagcggtggctgcccctgcaccctcctttaa

DBGET integrated database retrieval system