Oncorhynchus mykiss (rainbow trout): 110528412 Help Entry 110528412         CDS       T07259                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04081   Hormone signaling omy04144   Endocytosis omy04150   mTOR signaling pathway omy04270   Vascular smooth muscle contraction omy04310   Wnt signaling pathway omy04350   TGF-beta signaling pathway omy04510   Focal adhesion omy04517   IgSF CAM signaling omy04519   Cadherin signaling omy04520   Adherens junction omy04530   Tight junction omy04621   NOD-like receptor signaling pathway omy04625   C-type lectin receptor signaling pathway omy04810   Regulation of actin cytoskeleton omy05100   Bacterial invasion of epithelial cells omy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omy00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     110528412    04350 TGF-beta signaling pathway     110528412    04150 mTOR signaling pathway     110528412   09133 Signaling molecules and interaction    04081 Hormone signaling     110528412    04517 IgSF CAM signaling     110528412    04519 Cadherin signaling     110528412  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110528412   09144 Cellular community - eukaryotes    04510 Focal adhesion     110528412    04520 Adherens junction     110528412    04530 Tight junction     110528412   09142 Cell motility    04810 Regulation of actin cytoskeleton     110528412  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     110528412    04625 C-type lectin receptor signaling pathway     110528412   09153 Circulatory system    04270 Vascular smooth muscle contraction     110528412  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110528412    05100 Bacterial invasion of epithelial cells     110528412  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:omy04131]     110528412   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:omy04147]     110528412    04031 GTP-binding proteins [BR:omy04031]     110528412 Membrane trafficking [BR:omy04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     110528412 Exosome [BR:omy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110528412   Exosomal proteins of other body fluids (saliva and urine)    110528412   Exosomal proteins of colorectal cancer cells    110528412   Exosomal proteins of bladder cancer cells    110528412 GTP-binding proteins [BR:omy04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     110528412 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  110528412 NCBI-ProteinID:  XP_021466135 LinkDB All DBs Position 7:complement(71402972..71412268) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYMECSAKSKDGVREVFEMATRAALQ ARRGKQRHKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaatccgaaagaaactggtcatagtgggagacggagcgtgcgggaagacctgc ctgctcatcgtattcagtaaagaccagttcccagaggtctacgtgcccactgtcttcgag aactatgtcgctgacattgaggttgacagcaaacaggttgagttggcactatgggataca gcaggccaggaggactatgataggctccgtcccctctcttacccagatactgatgtcatc ctcatgtgcttttccattgatagccccgacagtttggaaaacatcccggagaagtggact ccagaagtcaaacacttctgccctaacgttcccattatcctagtgggcaacaaaaaggac ctgcgtaacgacgagcacacccgcagagagctagccaagatgaagcaggagcctgtgaag ccagaggaggggcgtgacatggcaaaccggatcagtgccttcggctacatggagtgctcc gcaaagagcaaggatggggtgagggaagtgtttgagatggccacgagggcggcgctacag gcccggcgggggaagcagagacataaatgcctcctactgtaa

DBGET integrated database retrieval system