Oncorhynchus mykiss (rainbow trout): 110537203 Help Entry 110537203         CDS       T07259                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04068   FoxO signaling pathway omy04136   Autophagy - other omy04140   Autophagy - animal omy04621   NOD-like receptor signaling pathway omy04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:omy00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     110537203  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110537203    04136 Autophagy - other     110537203  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     110537203    04622 RIG-I-like receptor signaling pathway     110537203  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:omy04131]     110537203    04121 Ubiquitin system [BR:omy04121]     110537203    03029 Mitochondrial biogenesis [BR:omy03029]     110537203 Membrane trafficking [BR:omy04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     110537203 Ubiquitin system [BR:omy04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    110537203 Mitochondrial biogenesis [BR:omy03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     110537203 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  110537203 NCBI-ProteinID:  XP_036824561 Ensembl:  ENSOMYG00000002850 UniProt:  A0A1U9W5J8 LinkDB All DBs Position 3:complement(10937442..10941795) Genome browser AA seq 120 aa AA seqDB search MSDNAESPTETQKDEPSTPQQPTEDSGMADDKKKIDVLLKAVGDTPIMKTKKWSVEKGRT VQSLSQFISRFLKMEANEQLFIYVNQSFSPSPDQEVGVLFECFGSDGKLVLHYCKSQAWG NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaacgcagagtctcctacagaaacgcaaaaagatgagccttcaaccccacaa cagcctacggaagactcggggatggcagacgataagaaaaaaattgatgtgttgttgaag gcagtaggagacacccccatcatgaagacaaagaaatggtcggtagagaaagggaggaca gtgcaatcactctctcaattcatctctcgattcctcaagatggaggccaatgaacagctg ttcatttacgtcaaccagtcattctctccctcgcctgatcaggaagtaggagtcctgttt gaatgttttggcagcgatgggaagcttgttctacattattgtaaatctcaagcctggggt taa

DBGET integrated database retrieval system