Oncorhynchus mykiss (rainbow trout): 118940335 Help Entry 118940335         CDS       T07259                                  Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04814   Motor proteins Brite KEGG Orthology (KO) [BR:omy00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     118940335  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:omy03037]     118940335    04812 Cytoskeleton proteins [BR:omy04812]     118940335 Cilium and associated proteins [BR:omy03037]  Motile cilia and associated proteins   Dynein arm    118940335 Cytoskeleton proteins [BR:omy04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      118940335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Ground-like Motif Other DBs NCBI-GeneID:  118940335 NCBI-ProteinID:  XP_036805004 UniProt:  A0A8K9XL88 LinkDB All DBs Position 17:16427977..16431459 Genome browser AA seq 106 aa AA seqDB search MAETAESKKEEADYKRLHSFPLIRHTDMPEEMRVETMELCVTACEKFATNNESAAKMIKE SMDKKFGSSWHVVIGEGFGFEVTHEVKNLLYMFFGGSLAVCVWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggcagagacagcagagagtaagaaagaagaggcagactacaaaaggctgcacagcttt cctcttatcaggcacacagacatgccagaggagatgagagtggagaccatggagctctgt gtcacagcctgcgagaagttcgccaccaacaatgagagtgcagcgaagatgatcaaggag tcaatggataagaagtttggcagctcgtggcacgtggtaatcggcgagggctttggcttc gaggtgacacacgaggtcaagaacctgctctacatgttctttggaggaagcctggccgtg tgtgtctggaagtgctcctag

DBGET integrated database retrieval system