Oncorhynchus mykiss (rainbow trout): 118946006 Help Entry 118946006         CDS       T07259                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04010   MAPK signaling pathway omy04068   FoxO signaling pathway omy04081   Hormone signaling omy04114   Oocyte meiosis omy04140   Autophagy - animal omy04150   mTOR signaling pathway omy04810   Regulation of actin cytoskeleton omy04910   Insulin signaling pathway omy04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:omy00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118946006    04068 FoxO signaling pathway     118946006    04150 mTOR signaling pathway     118946006   09133 Signaling molecules and interaction    04081 Hormone signaling     118946006  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118946006   09143 Cell growth and death    04114 Oocyte meiosis     118946006   09142 Cell motility    04810 Regulation of actin cytoskeleton     118946006  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     118946006    04914 Progesterone-mediated oocyte maturation     118946006  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:omy04052]     118946006 Cytokines and neuropeptides [BR:omy04052]  Neuropeptides   Unclassified    118946006 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta NrfD_2 Motif Other DBs NCBI-GeneID:  118946006 NCBI-ProteinID:  XP_036825568 LinkDB All DBs Position 31:15411966..15414423 Genome browser AA seq 116 aa AA seqDB search MAVVVWALSVLLLLVLSSPGVCSAPSAQHLCGSHLVDALYLVCGEQGFFYNPHRIPRDLL LQHLIGFLSRKSRQGWRVKQERPWKKDHEDQKVKRGIVEQCCHKPCSFSHLQSYCD NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggctgtggtagtatgggccctgtctgttctgttactgctggtcctgtcttccccgggg gtctgctcagctcccagcgcccagcacctgtgtggctctcacctggtggatgccctctac ctggtctgtggggaacaagggttcttctataacccccacagaatccccagagacctactc ctgcaacaccttatagggttcctgtctaggaagagcagacagggttggagggtgaagcag gaacgtccatggaagaaggaccatgaagaccagaaggtgaaaagaggcattgtggaacag tgctgtcataagccatgtagcttcagccacctgcagagctactgcgactga

DBGET integrated database retrieval system