Oncorhynchus mykiss (rainbow trout): 118962845 Help Entry 118962845         CDS       T07259                                  Name (RefSeq) actin-related protein 3B-like   KO K18584   actin-related protein 3 Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04144   Endocytosis omy04530   Tight junction omy04810   Regulation of actin cytoskeleton omy05100   Bacterial invasion of epithelial cells omy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omy00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118962845   09144 Cellular community - eukaryotes    04530 Tight junction     118962845   09142 Cell motility    04810 Regulation of actin cytoskeleton     118962845  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118962845    05100 Bacterial invasion of epithelial cells     118962845  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:omy04131]     118962845   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:omy04812]     118962845    04147 Exosome [BR:omy04147]     118962845 Membrane trafficking [BR:omy04131]  Others   Actin-binding proteins    Arp2/3 complex     118962845 Cytoskeleton proteins [BR:omy04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Arp2/3 complex      118962845 Exosome [BR:omy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118962845   Exosomal proteins of other body fluids (saliva and urine)    118962845   Exosomal proteins of bladder cancer cells    118962845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Sulfotransfer_3 ALP_N Robl_LC7 Motif Other DBs NCBI-GeneID:  118962845 NCBI-ProteinID:  XP_036830559 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MATPLPPCVIDCGTGYTKIGYAGNTEPQFIMPSCIAIRESAGVGDQAQRRLAKGVDDLDF FIGDEGIDKPNYATKWPIRHGMVEDWDLMEKFMEQIIFKYLRAEPEDHSFLMTEPPLNTP ENREYLAEIMFETFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHAIPV AEGYVIG NT seq 562 nt NT seq  +upstreamnt  +downstreamnt atggcaactcctctacctccttgcgtgatagattgtgggacaggatacaccaagattgga tatgctggaaacacagagccacagtttatcatgccatcctgcatcgctatacgagagtca gccggtgtaggagaccaggcacagaggcgacttgcgaagggagtggatgacttggatttc tttataggagatgaaggcattgataagcccaactatgcaaccaagtggcccatcagacat gggatggtggaagactgggatttgatggagaagttcatggagcagatcatcttcaagtat ctgcgggcagagcctgaagaccatagcttccttatgacagagcctccgttgaacacgcca gagaacagagagtatctggctgagatcatgtttgagacctttaatgtcccaggcctgtac atcgcagtgcaggcagttctagccctggcagcatcatggacgtctagacaagtaggcgag cgaacactgacaggaatcgtgattgacagcggagatggagtcacccacgccatacctgtg gctgaaggctacgtcattggga

DBGET integrated database retrieval system