Oncorhynchus nerka (sockeye salmon): 115101029 Help Entry 115101029         CDS       T07952                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04137   Mitophagy - animal one04140   Autophagy - animal one04144   Endocytosis one04145   Phagosome one04148   Efferocytosis one05132   Salmonella infection Brite KEGG Orthology (KO) [BR:one00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115101029    04145 Phagosome     115101029    04140 Autophagy - animal     115101029    04137 Mitophagy - animal     115101029    04148 Efferocytosis     115101029  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115101029  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:one04131]     115101029   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:one04147]     115101029    04031 GTP-binding proteins [BR:one04031]     115101029 Membrane trafficking [BR:one04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     115101029 Exosome [BR:one04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115101029   Exosomal proteins of other body fluids (saliva and urine)    115101029   Exosomal proteins of colorectal cancer cells    115101029   Exosomal proteins of bladder cancer cells    115101029 GTP-binding proteins [BR:one04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     115101029 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW PduV-EutP ATP_bind_1 nSTAND3 AAA_16 Septin NTPase_1 AAA_7 AAA_22 AAA_24 DUF5992 G-alpha AAA_5 SRPRB ATPase_2 NB-ARC NACHT AAA_14 ATP-synt_ab Motif Other DBs NCBI-GeneID:  115101029 NCBI-ProteinID:  XP_029476039 EnsemblRapid:  ENSONEG00000029136 LinkDB All DBs Position LG19:complement(8529148..8538302) Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPDNFPF VVLGNKIDLENRQVTTKRAQAWCASKSSIPYFETSAKEAINVEQAFQTIARNALKQESEV ETYDFPDQIKLRDDRPADPSDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcctcccgtaagaaggtgctgctgaaggtgatcatcctcggagactctggggtaggg aagacttctctgatgaaccagtatgtaaataagaagttcagtaaccagtacaaggccact ataggagcggacttcctcaccaaggaggtgatggtggatgacaggctggtcaccatgcag atctgggacacggcggggcaggagcgtttccagtctctgggcgtggcgttctaccgcggc gctgactgctgtgtgctggtctacgatgtcacggcgcccaacaccttcaagacactggac agctggagggatgagttcctgatccaggccagccccagagacccagataacttccccttt gtggtgctaggcaacaagattgacctggagaacagacaggtgacgacaaaacgtgcccag gcctggtgtgccagtaagagcagcatcccctactttgagaccagcgccaaggaggccatc aacgtagaacaagcattccagaccattgcccgcaatgcccttaaacaggagtctgaggtg gagacgtatgacttcccagaccagatcaaactgagagacgaccggcccgccgaccccagc gacggctgctcctgctga

DBGET integrated database retrieval system