Oncorhynchus nerka (sockeye salmon): 115104644 Help Entry 115104644         CDS       T07952                                  Name (RefSeq) insulin   KO K04526   insulin Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04010   MAPK signaling pathway one04068   FoxO signaling pathway one04081   Hormone signaling one04114   Oocyte meiosis one04140   Autophagy - animal one04150   mTOR signaling pathway one04810   Regulation of actin cytoskeleton one04910   Insulin signaling pathway one04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:one00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115104644    04068 FoxO signaling pathway     115104644    04150 mTOR signaling pathway     115104644   09133 Signaling molecules and interaction    04081 Hormone signaling     115104644  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     115104644   09143 Cell growth and death    04114 Oocyte meiosis     115104644   09142 Cell motility    04810 Regulation of actin cytoskeleton     115104644  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     115104644    04914 Progesterone-mediated oocyte maturation     115104644  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:one04052]     115104644 Cytokines and neuropeptides [BR:one04052]  Neuropeptides   Unclassified    115104644 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  115104644 NCBI-ProteinID:  XP_029481856 LinkDB All DBs Position LG22:complement(42597484..42598719) Genome browser AA seq 105 aa AA seqDB search MAFWLQAASLLVLLALSPGTDAAAAQHLCGSHLVDALYLVCGEKGFFYNPKRDVDPLIGF LSPKSAKENEEYPFKDQTEMMVKRGIVEQCCHKPCNIFDLQNYCN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggccttctggctccaagctgcatctctgctggtgttgctggcgctctccccagggaca gacgctgcagctgcccagcacctgtgtggctctcacctggtggacgccctctatctggtg tgtggagagaaaggattcttttacaacccaaagagagatgtggatccccttatagggttc ctctctccaaaatcagcaaaggagaatgaagaataccccttcaaagaccagacggagatg atggtaaagagaggtattgtagagcagtgctgtcacaagccctgcaacatcttcgacctg caaaactactgcaactga

DBGET integrated database retrieval system