Oncorhynchus nerka (sockeye salmon): 115105286
Help
Entry
115105286 CDS
T07952
Name
(RefSeq) S-phase kinase-associated protein 1
KO
K03094
S-phase kinase-associated protein 1
Organism
one
Oncorhynchus nerka (sockeye salmon)
Pathway
one03083
Polycomb repressive complex
one04110
Cell cycle
one04114
Oocyte meiosis
one04120
Ubiquitin mediated proteolysis
one04141
Protein processing in endoplasmic reticulum
one04310
Wnt signaling pathway
one04350
TGF-beta signaling pathway
one05132
Salmonella infection
Brite
KEGG Orthology (KO) [BR:
one00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
115105286
04120 Ubiquitin mediated proteolysis
115105286
09126 Chromosome
03083 Polycomb repressive complex
115105286
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
115105286
04350 TGF-beta signaling pathway
115105286
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
115105286
04114 Oocyte meiosis
115105286
09160 Human Diseases
09171 Infectious disease: bacterial
05132 Salmonella infection
115105286
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
one04131
]
115105286
04121 Ubiquitin system [BR:
one04121
]
115105286
03036 Chromosome and associated proteins [BR:
one03036
]
115105286
Membrane trafficking [BR:
one04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
115105286
Ubiquitin system [BR:
one04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
115105286
Cul7 complex
115105286
Chromosome and associated proteins [BR:
one03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
115105286
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
115105286
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
115105286
NCBI-ProteinID:
XP_029482984
LinkDB
All DBs
Position
LG22:complement(34147834..34153193)
Genome browser
AA seq
163 aa
AA seq
DB search
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq
492 nt
NT seq
+upstream
nt +downstream
nt
atgcccacaattaaactgcaaagctcagatggagagatctttgaggtggatgtggaaata
gcaaagcagtctgttacaataaagacaatgctggaagatttgggtatggatgatgaagga
gatgatgatccagtccccctcccgaatgtgaatgcagccatcctcaagaaggtgatccag
tggtgcacccaccataaagacgacccccctccccccgaggatgacgagaacaaggagaag
aggacggacgacattcccgtctgggaccaggaattcctcaaagtggaccaagggaccctc
ttcgaactcattctggccgcaaactatttggacatcaaaggactgctagatgtcacctgc
aagacggtggccaacatgataaaaggcaagaccccagaggagatcaggaagacgttcaat
atcaaaaatgacttcacagaggaggaggaagcccaggtacgcaaggagaaccagtggtgt
gaagagaaataa
DBGET
integrated database retrieval system