Oncorhynchus nerka (sockeye salmon): 115109983 Help Entry 115109983         CDS       T07952                                  Name (RefSeq) ras-related protein R-Ras-like   KO K07830   Ras-related protein R-Ras2 Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04010   MAPK signaling pathway one04137   Mitophagy - animal one04140   Autophagy - animal one04218   Cellular senescence one04371   Apelin signaling pathway one04625   C-type lectin receptor signaling pathway one04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:one00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115109983    04371 Apelin signaling pathway     115109983  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     115109983    04137 Mitophagy - animal     115109983   09143 Cell growth and death    04218 Cellular senescence     115109983   09142 Cell motility    04810 Regulation of actin cytoskeleton     115109983  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     115109983  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:one04147]     115109983    04031 GTP-binding proteins [BR:one04031]     115109983 Exosome [BR:one04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    115109983   Exosomal proteins of bladder cancer cells    115109983 GTP-binding proteins [BR:one04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     115109983 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  115109983 NCBI-ProteinID:  XP_029491136 LinkDB All DBs Position LG26:1789223..1807935 Genome browser AA seq 197 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDTGSYNEIHKFHTQILRVKDRDDFPMVLVGN KADLDQSRAISREEAQGFARENRIHYMEASAKNRYNVDEAFLEVVRAIRKFQETESPPLP ANHTGKRKSGGCPCTLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgtctgctgaggaggagagattcaaactggtcgtcgtgggcgggggcggtgtggggaaa agcgccttgaccatacaatttattcagtcatactttgtatcggattatgaccccaccatc gaggactcctacaccaaaatatgcacagtggatgggaaagagacacggttagacatcttg gacacagcaggtcaggaggagtttggggcaatgagggagcagtacatgcgctcaggggaa ggcttcttgctggtgttcgctctgaatgacactggcagttacaatgagatccacaagttc cacacccagatactgagagtgaaggaccgggatgacttccccatggtgctggtggggaac aaggctgacctggaccagtcgagagcgatctccagagaggaggcccagggctttgccaga gagaacaggatccattacatggaggcctctgctaagaaccgctacaacgtagacgaagcc ttcctggaggtggtgcgagctataagaaagtttcaggagactgagagtccccctctacct gcaaaccacacaggaaaacggaagagcggtggctgcccctgcaccctcctttaa

DBGET integrated database retrieval system