Oncorhynchus nerka (sockeye salmon): 115110776 Help Entry 115110776         CDS       T07952                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:one00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     115110776  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:one04121]     115110776    03400 DNA repair and recombination proteins [BR:one03400]     115110776 Ubiquitin system [BR:one04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      115110776    Cul5 complex      115110776 DNA repair and recombination proteins [BR:one03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      115110776 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  115110776 NCBI-ProteinID:  XP_029492535 LinkDB All DBs Position LG26:complement(24792131..24796496) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEEQRLYKDDMLLEDSKTLGDC GFTNQTARPQAPGTVGLAFRLGDDAFEQLRVEPFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctgatgatcaggcgtcacaagacgaccatcttcactgatgccaaagag tccactacggtctacgagctgaagcgcatagtggagggtatcctaaagagggcaccggag gaacagaggctgtacaaggatgacatgttgctggaggatagtaagactcttggagactgt ggcttcacaaatcagacagccagacctcaggccccagggactgttggattagctttccgt ctcggtgatgatgcatttgagcagctgagggttgagcccttctccagccccccagagctt cctgacgtcatgaagcctcaggactctggcagcacagccaatgagcaggccgtgcagtga

DBGET integrated database retrieval system