Oncorhynchus nerka (sockeye salmon): 115111952 Help Entry 115111952         CDS       T07952                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04068   FoxO signaling pathway one04136   Autophagy - other one04140   Autophagy - animal one04621   NOD-like receptor signaling pathway one04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:one00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     115111952 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     115111952 (atg12)    04136 Autophagy - other     115111952 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     115111952 (atg12)    04622 RIG-I-like receptor signaling pathway     115111952 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:one04131]     115111952 (atg12)    04121 Ubiquitin system [BR:one04121]     115111952 (atg12)    03029 Mitochondrial biogenesis [BR:one03029]     115111952 (atg12) Membrane trafficking [BR:one04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     115111952 (atg12) Ubiquitin system [BR:one04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    115111952 (atg12) Mitochondrial biogenesis [BR:one03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     115111952 (atg12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  115111952 NCBI-ProteinID:  XP_029494378 LinkDB All DBs Position LG27:35953090..35957762 Genome browser AA seq 120 aa AA seqDB search MSDNAESPTETQKDEPSTPQQSTEGSGMADDKKKIDVLLKAVGDTPIMKTKKWSVEKGRT VQSLSQFISRFLKMEANEQLFIYVNQSFSPSPDQEVGVLFECFGSDGKLVLHYCKSQAWG NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaacgcagagtctcctacagaaacgcaaaaagatgagccttcaaccccacaa cagtctacggaaggctcggggatggcagacgataagaaaaaaattgatgtgttgttgaag gcagtaggagacacccccatcatgaagacaaagaaatggtctgtagagaaagggaggaca gtgcaatcactctctcaattcatctctcgattcctcaagatggaggccaatgaacagctg ttcatttacgtcaaccagtcattctctccctcgcctgatcaggaagtaggagtcctgttt gaatgttttggcagcgatgggaagcttgttctacattactgtaaatctcaagcctggggt taa

DBGET integrated database retrieval system