Oncorhynchus nerka (sockeye salmon): 115118270 Help Entry 115118270         CDS       T07952                                  Name (RefSeq) ras-related protein Rab-13-like   KO K06109   Ras-related protein Rab-13 Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04530   Tight junction Brite KEGG Orthology (KO) [BR:one00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     115118270  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:one04131]     115118270   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:one04147]     115118270    04031 GTP-binding proteins [BR:one04031]     115118270 Membrane trafficking [BR:one04131]  Protein recycling   Rab GTPases and associated proteins    Rab GTPases     115118270 Exosome [BR:one04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    115118270   Exosomal proteins of colorectal cancer cells    115118270 GTP-binding proteins [BR:one04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     115118270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Motif Other DBs NCBI-GeneID:  115118270 NCBI-ProteinID:  XP_029502708 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MRDTSLKYKMDDNSLSFIPQNASAGVSRMLLANKCDIEAKRKVSKETGEKLAKDHGIRFF ETSAKASINVDESFMALARDILLKSSKKPGPTGREVKITNAEKKSSKCLLL NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgagggatacatcattgaaatataaaatggatgacaactccctatcttttatcccccag aatgcatcagcgggggtcagccggatgttgctagctaacaagtgtgacattgaggccaag aggaaggtatccaaggaaacgggggaaaagctggcaaaggatcatgggatcagattcttt gagaccagtgcaaaggccagcatcaatgttgatgagtcttttatggctttggctcgagat attctactgaagtccagcaagaagccgggccccacaggtcgcgaggtcaaaatcaccaac gctgagaagaaatcctccaaatgtctcctactgtag

DBGET integrated database retrieval system