Oncorhynchus nerka (sockeye salmon): 115121275 Help Entry 115121275         CDS       T07952                                  Name (RefSeq) fibroblast growth factor 20-like   KO K04358   fibroblast growth factor Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04010   MAPK signaling pathway one04020   Calcium signaling pathway one04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:one00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115121275    04020 Calcium signaling pathway     115121275  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     115121275  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:one04052]     115121275    00536 Glycosaminoglycan binding proteins [BR:one00536]     115121275 Cytokines and neuropeptides [BR:one04052]  Cytokines   Growth factors (RTK binding)    115121275 Glycosaminoglycan binding proteins [BR:one00536]  Heparan sulfate / Heparin   Growth factors/receptors    115121275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  115121275 NCBI-ProteinID:  XP_029506194 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MGAVGEVGTFSLHGLDSFGHGSHFVLTPAGDTPGLMSEHLVSAERLSRSTPSDLTHLKGI LRRRQLYCRTGFHLEILPDGTVQGTRKDHSRFGILEFISLAVGMVSIRGVDSGLYLGMNS KGDLYGS NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgggggcagtgggcgaggtgggtacattttccttgcacggcctggatagcttcggacac ggatcgcattttgtcctgacgcccgctggggacacccccggactgatgagcgagcacctg gtgtcggccgagaggttgtcgcggagcacgccgtcggatctgacgcatctgaaggggatt ctacggaggaggcagctgtactgcaggaccgggttccacctcgagatactgcccgatggc acagtgcaaggcaccaggaaagaccatagcagatttggtattttggagttcatcagcttg gctgtggggatggtgagcatccgtggggtggacagtggattatacctgggcatgaacagc aagggagacctctacggctct

DBGET integrated database retrieval system