Oncorhynchus nerka (sockeye salmon): 115122030 Help Entry 115122030         CDS       T07952                                  Name (RefSeq) protein S100-A1-like isoform X1   KO K17274   protein S100-A10 Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04382   Cornified envelope formation one05132   Salmonella infection Brite KEGG Orthology (KO) [BR:one00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     115122030  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115122030  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:one04147]     115122030 Exosome [BR:one04147]  Exosomal proteins   Exosomal proteins of microglial cells    115122030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 Astro_p19 DUF826 Motif Other DBs NCBI-GeneID:  115122030 NCBI-ProteinID:  XP_029507038 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MPSELERSMESLIMVFHLYSEKDGDGNTLSKKELKELMKTELASFLKSQKDPAAIDTIMK DLDQNGDGKVNFEEFVSLVVGLSIACEQLYQLHTQKASAKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgagttggagcgttccatggagtccctgatcatggtgttccatctctattct gaaaaggatggtgatggcaacacactgagcaagaaggagctcaaagagctgatgaagaca gaactggccagcttcctgaagtcccagaaggacccagccgccatagacacgatcatgaag gatctggaccagaatggtgatgggaaggtaaactttgaggagtttgtctctctggtggtg ggcctctccattgcctgtgaacagctctaccagctccacacccagaaggcttctgccaag aagtga

DBGET integrated database retrieval system