Oncorhynchus nerka (sockeye salmon): 115126445 Help Entry 115126445         CDS       T07952                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04382   Cornified envelope formation one05132   Salmonella infection Brite KEGG Orthology (KO) [BR:one00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     115126445  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115126445  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:one04147]     115126445 Exosome [BR:one04147]  Exosomal proteins   Exosomal proteins of microglial cells    115126445 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_FSTL1 EH EF-hand_STIM1 Motif Other DBs NCBI-GeneID:  115126445 NCBI-ProteinID:  XP_029511926 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search CILLSAAMLSQLERSMQSLITVFHRYADKDGDCNTLSKKDLNELMQSELASFLKSQKDPA AIDKIMKNLDQNGDGMVNFEEFVSLVVDLSIACEQIYQLHTQKAAAKK NT seq 327 nt NT seq  +upstreamnt  +downstreamnt tgtatccttctctctgcagccatgctgtctcagttggagagatccatgcagtccctgatc acggtgttccatcgctatgccgacaaggacggtgactgtaacacactgagcaagaaggat ctgaatgaactcatgcagtcagaactggccagcttcctgaagtcccaaaaggacccagcc gccatagacaagatcatgaagaatctggaccagaatggtgatgggatggtaaactttgag gagtttgtctccctggtggtggacctctccatcgcctgtgaacagatctaccagctccac acccagaaggctgccgctaagaagtga

DBGET integrated database retrieval system