Oncorhynchus nerka (sockeye salmon): 115132763 Help Entry 115132763         CDS       T07952                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04382   Cornified envelope formation one05132   Salmonella infection Brite KEGG Orthology (KO) [BR:one00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     115132763  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115132763  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:one04147]     115132763 Exosome [BR:one04147]  Exosomal proteins   Exosomal proteins of microglial cells    115132763 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 DAXX_hist_bd NNH2 EH MCM4_WHD Motif Other DBs NCBI-GeneID:  115132763 NCBI-ProteinID:  XP_029521363 LinkDB All DBs Position LG7:complement(23641953..23644061) Genome browser AA seq 99 aa AA seqDB search MPSDLERAMESMITVFHKYAAKEGSGNTLSRRELRDLMENELSGFLKSQKDPATVDKIMK DLDSNGDGEVDFEEFVSLVVGLSIACEQCYQMHKKKMGK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccatcagacctggaacgagcaatggagtccatgatcactgtgttccacaagtatgct gctaaggagggcagtggcaacactctgagccgccgtgagctaagggacctgatggagaac gagctctctggcttcctcaagtctcagaaggacccagccacagtagacaagatcatgaag gatctggactctaatggtgatggagaggtggactttgaggagtttgtttctctagttgtg ggcctgtccatcgcctgtgaacagtgctaccagatgcacaagaagaagatggggaagtga

DBGET integrated database retrieval system