Oncorhynchus nerka (sockeye salmon): 115133632 Help Entry 115133632         CDS       T07952                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism one  Oncorhynchus nerka (sockeye salmon) Brite KEGG Orthology (KO) [BR:one00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:one01002]     115133632   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:one04147]     115133632 Peptidases and inhibitors [BR:one01002]  Peptidase inhibitors   Family I25: cystatin family    115133632 Exosome [BR:one04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    115133632 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  115133632 NCBI-ProteinID:  XP_029522927 LinkDB All DBs Position LG8:31658665..31660416 Genome browser AA seq 99 aa AA seqDB search MPLCGGTTGPKDATEEVQKICDEMKPHAEQKTGRNFDVFTAKIYKTQVVAGTNFFIKVHV GGEDHVHLRVYKMLPHAGSKLELTSLQESKAHSDPIEYF NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccattgtgtggaggaacaactgggccaaaggatgccactgaggaggtgcagaagatt tgtgatgagatgaagccgcatgcagagcagaaaacggggaggaattttgacgttttcaca gcgaaaatttacaagactcaggtggtggcagggaccaacttcttcatcaaggttcatgtt ggtggtgaagaccatgtccacctgcgcgtgtataaaatgctgccacacgccggaagcaaa ctggagctgaccagcctgcaggagtccaaagcccacagcgaccccatcgagtacttctga

DBGET integrated database retrieval system